PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01005386G0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 412aa    MW: 46270.2 Da    PI: 9.6803
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01005386G0020genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.64.5e-23136180145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrC RtDGKkWRCs+++++++k+CErH++r+r+rsrk++e+
  PH01005386G0020 136 DPEPGRCHRTDGKKWRCSKEAMADHKYCERHINRNRHRSRKPVES 180
                      79****************************************986 PP

2QLQ57.34.7e-2078113237
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      +FT++Q+++L++Q+l+yKyL+a++P+P+ Ll  i+k
  PH01005386G0020  78 PFTPSQWMELEHQALIYKYLNAKAPIPSSLLISISK 113
                      9******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.6E-1177113IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.76278113IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.4E-1478111IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.681136180IPR014977WRC domain
PfamPF088792.8E-19137179IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MELGEVLGLQ GLGVPSPKES DLGLTKRSNF TQAASYPSPF LDEQKILRFS KAAHTLPSGM  60
DFGRSNEHMF LLSRTKRPFT PSQWMELEHQ ALIYKYLNAK APIPSSLLIS ISKSFRSSNR  120
MSWRPLYQGF KSAESDPEPG RCHRTDGKKW RCSKEAMADH KYCERHINRN RHRSRKPVES  180
QTRKTTKEIP AAGSLSSPVS QGSFKKAKVN ELKPGSVSYW TDSLNRTMLS KEKANKPAED  240
NNAPLLNSTN RQPTLSLLCQ LKQQNKPDKF SPTVDSESIS SNTALKPWES SNQQSNKSIS  300
CTRLLDRECL QSVLQNFSLP KNEKIESQKN KASNPIQVSS TFYSSPEGPR ISCLTSNMTQ  360
VQEDCISSSW EMPQGGPLGE ILTNSKNTED LTNKCESRSY GWLLNLEDHE M*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006650403.10.0PREDICTED: growth-regulating factor 9
SwissprotQ9FRG80.0GRF9_ORYSJ; Growth-regulating factor 9
TrEMBLJ3LRI90.0J3LRI9_ORYBR; Uncharacterized protein
STRINGOB03G36650.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131242529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.18e-38growth-regulating factor 1